FASTA formatı

Bu içerik, Evrim Ağacı Bilim Sözlüğü dahilindeki bir terimdir. Sözlüğümüzü kullanarak bilimsel terimlerin anlamlarını ve yabancı dillerdeki karşılıkların görebilirsiniz. Ayrıca bu terimler, diğer içeriklerimiz içerisinde geçtiklerinde, okurlarımıza kolaylık olması ve yol göstermesi açısından açılır-kapanır bilgi kutusu olarak gösterilmektedir.

Terim

FASTA formatı

İngilizce

fasta-formati

Açıklama

DNA ve protein sekansları için evrensel yazı formatıdır. ">" işareti ile başlayıp tek satırlık tanımlamadan sonra sekans bilgileri ile devam eder.>gi|129295|sp|P01013|OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED)
QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE
KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS
VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP
FLFLIKHNPTNTIVYFGRYWSPhttp://www.bioinformatics.nl/tools/crab_fasta.html

F- (eksi) suş

Döllenme

Yazar

Çağrı Mert Bakırcı

Çağrı Mert Bakırcı

Yazar

Evrim Ağacı'nın kurucusu ve idari sorumlusudur. Popüler bilim yazarı ve anlatıcısıdır. Doktorasını Texas Tech Üniversitesi'nden almıştır. Araştırma konuları evrimsel robotik, yapay zeka ve teorik/matematiksel evrimdir.

Katkı Sağlayanlar

Konuyla Alakalı İçerikler

Göster

Şifremi unuttum Üyelik Aktivasyonu

Göster

Göster

Şifrenizi mi unuttunuz? Lütfen e-posta adresinizi giriniz. E-posta adresinize şifrenizi sıfırlamak için bir bağlantı gönderilecektir.

Geri dön

Eğer aktivasyon kodunu almadıysanız lütfen e-posta adresinizi giriniz. Üyeliğinizi aktive etmek için e-posta adresinize bir bağlantı gönderilecektir.

Geri dön

Close
Geri Bildirim